CDKN1A Antibody - middle region (ARP86723_P050)

Catalog No: ARP86723_P050

Host: Rabbit
Target Name: CDKN1A
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDKN1A
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDKN1A (ARP86723_P050) antibody is Catalog # AAP86723

Target Info

• Gene Symbol: CDKN1A
• Gene Full Name: cyclin dependent kinase inhibitor 1A
• Alias Symbols: P21, CIP1, SDI1, WAF1, CAP20, CDKN1, MDA-6, p21CIP1
• NCBI Gene Id: 1026
• Protein Name: Cyclin-dependent kinase inhibitor 1
• Description of Target: This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene.
• Uniprot ID: P38936
• Protein Accession #: NP_000380.1
• Nucleotide Accession #: NM_000389.4
• Protein Size (# AA): 164
• Molecular Weight: 18 kDa