Catalog No: AVARP03004_T100
Price: $0.00
SKU
AVARP03004_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CDK9 (AVARP03004_T100) antibody
Product Info
ReferenceLi,Q., (2005) J. Biol. Chem. 280 (31), 28819-28826
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CDK9
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: PFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
Concentration1.0 mg/ml
Blocking PeptideFor anti-CDK9 (AVARP03004_T100) antibody is Catalog # AAP30157
Gene SymbolCDK9
Gene Full NameCyclin-dependent kinase 9
Alias SymbolsTAK, C-2k, CTK1, CDC2L4, PITALRE
NCBI Gene Id1025
Protein NameCyclin-dependent kinase 9
Description of TargetCDK9 is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS.The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS.
Uniprot IDP50750
Protein Accession #NP_001252
Nucleotide Accession #NM_001261
Protein Size (# AA)372
Molecular Weight43kDa
Protein InteractionsUBC; MEPCE; tat; LARP7; BRD4; CCNT1; ATM; SUMO2; AFF1; HEXIM1; FKBP5; RNF20; MSL2; RNF40; HIST2H2BE; POLR2A; MSL1; CDK9; SMC2; PLEC; CCAR2; SMC4; STIP1; MLLT3; MLLT1; CDK12; AFF4; FGFR1; CCNT2; AFF3; FBXO25; CUL1; SKIV2L; ATP1A1; SUPT5H; RPS4X; RN7SK; HEX
  1. What is the species homology for "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish".

  2. How long will it take to receive "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CDK9 Antibody - N-terminal region (AVARP03004_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    This target may also be called "TAK, C-2k, CTK1, CDC2L4, PITALRE" in publications.

  5. What is the shipping cost for "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CDK9 Antibody - N-terminal region (AVARP03004_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CDK9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CDK9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CDK9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CDK9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CDK9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CDK9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CDK9 Antibody - N-terminal region (AVARP03004_T100)
Your Rating
We found other products you might like!