CDK4 Antibody (OABB02018)

Catalog No: OABB02018

Size:100UG

Anti-Cdk4 Picoband antibody, OABB02018, Western blotting
All lanes: Anti Cdk4 (OABB02018) at 0.5ug/ml
Lane 1: Rat Gaster Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: SKOV Whole Cell Lysate at 40ug
Lane 6: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 34KD
Observed bind size: 34KD

Anti-Cdk4 Picoband antibody, OABB02018, IHC(P)
IHC(P): Human Lung Cancer Tissue

Anti-Cdk4 Picoband antibody, OABB02018, IHC(P)
IHC(P): Mouse Intestine Tissue

Anti-Cdk4 Picoband antibody, OABB02018, IHC(P)
IHC(P): Rat Intestine Tissue

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Immunofluorescence|Immunohistochemistry|Western blot
• Additional Information: Notes: Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. Human cell division is regulated primarily at the G1-to-S or the G2-to-M boundaries within the cell cycle. The complexes formed by CDK4 and the D-type cyclins are involved in the control of cell proliferation during the G1 phase. CDK4 is inhibited by p16, also known as cyclin-dependent kinase inhibitor-2. CDK4 is mapped to 12q14. And CDK4 expression and activity are required for cytokine responsiveness in T cells.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E.coli-derived human Cdk4 recombinant protein (Position: G201-E303). Human Cdk4 shares 94.2% amino acid (aa) sequence identity with both mouse and rat Cdk4.
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: GCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Rat
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat
• Reference: 1. Demetrick, D. J.; Zhang, H.; Beach, D. H.: Chromosomal mapping of human CDK2, CDK4, and CDK5 cell cycle kinase genes. Cytogenet. Cell Genet. 66: 72-74, 1994.
  2. Modiano, J. F.; Mayor, J.; Ball, C.; Fuentes, M. K.; Linthicum, D. S.: CDK4 expression and activity are required for cytokine responsiveness in T cells. J. Immun. 165: 6693-6702, 2000.e for human proliferating nuclear antigen/cyclin by in situ hybridization. Hum. Genet. 86: 84-86, 1990.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 4(CDK4) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Target Info

• Gene Symbol: CDK4
• Gene Full Name: cyclin dependent kinase 4
• Alias Symbols: cell division protein kinase 4;CMM3;cyclin-dependent kinase 4;PSK-J3.
• NCBI Gene Id: 1019
• Protein Name: Cyclin-dependent kinase 4
• Description of Target: Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
• Uniprot ID: P11802
• Molecular Weight: 33730 MW