- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CDK4 Antibody (OABB02018) |
---|
Tested Species Reactivity | Human, Mouse, Rat |
---|---|
Predicted Species Reactivity | Human|Mouse|Rat |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Immunofluorescence|Immunohistochemistry|Western blot |
Additional Information | Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. Human cell division is regulated primarily at the G1-to-S or the G2-to-M boundaries within the cell cycle. The complexes formed by CDK4 and the D-type cyclins are involved in the control of cell proliferation during the G1 phase. CDK4 is inhibited by p16, also known as cyclin-dependent kinase inhibitor-2. CDK4 is mapped to 12q14. And CDK4 expression and activity are required for cytokine responsiveness in T cells. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E.coli-derived human Cdk4 recombinant protein (Position: G201-E303). Human Cdk4 shares 94.2% amino acid (aa) sequence identity with both mouse and rat Cdk4. |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: GCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Rat Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat |
Reference | 1. Demetrick, D. J.; Zhang, H.; Beach, D. H.: Chromosomal mapping of human CDK2, CDK4, and CDK5 cell cycle kinase genes. Cytogenet. Cell Genet. 66: 72-74, 1994. 2. Modiano, J. F.; Mayor, J.; Ball, C.; Fuentes, M. K.; Linthicum, D. S.: CDK4 expression and activity are required for cytokine responsiveness in T cells. J. Immun. 165: 6693-6702, 2000.e for human proliferating nuclear antigen/cyclin by in situ hybridization. Hum. Genet. 86: 84-86, 1990. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 4(CDK4) detection. Tested with WB, IHC-P in Human;Mouse;Rat. |
Gene Symbol | CDK4 |
---|---|
Gene Full Name | cyclin dependent kinase 4 |
Alias Symbols | cell division protein kinase 4;CMM3;cyclin-dependent kinase 4;PSK-J3. |
NCBI Gene Id | 1019 |
Protein Name | Cyclin-dependent kinase 4 |
Description of Target | Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. |
Uniprot ID | P11802 |
Molecular Weight | 33730 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CDK4 Antibody (OABB02018)"?
The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "CDK4 Antibody (OABB02018)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "CDK4 Antibody (OABB02018)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CDK4 Antibody (OABB02018)"?
This target may also be called "cell division protein kinase 4;CMM3;cyclin-dependent kinase 4;PSK-J3." in publications.
-
What is the shipping cost for "CDK4 Antibody (OABB02018)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CDK4 Antibody (OABB02018)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CDK4 Antibody (OABB02018)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "33730 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CDK4 Antibody (OABB02018)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CDK4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CDK4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CDK4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CDK4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CDK4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CDK4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.