Search Antibody, Protein, and ELISA Kit Solutions

CDK2 Antibody - middle region (ARP30331_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30331_P050-FITC Conjugated

ARP30331_P050-HRP Conjugated

ARP30331_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Cyclin-dependent kinase 2
NCBI Gene Id:
Protein Name:
Cyclin-dependent kinase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-136191 from Santa Cruz Biotechnology.
Description of Target:
Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDK2.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CDK2 (ARP30331_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CDK2 (ARP30331_P050) antibody is Catalog # AAPP45995
Printable datasheet for anti-CDK2 (ARP30331_P050) antibody
Sample Type Confirmation:

CDK2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat


Huang, CX; Chen, N; Wu, XJ; Huang, CH; He, Y; Tang, R; Wang, WM; Wang, HL; The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1α and functions in cellular adaptations. 29, 4901-13 (2015). WB, IHC, Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26265472

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...