Search Antibody, Protein, and ELISA Kit Solutions

CDK2 antibody - middle region (ARP30331_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30331_P050-FITC Conjugated

ARP30331_P050-HRP Conjugated

ARP30331_P050-Biotin Conjugated

Gene Symbol:
CDK2
NCBI Gene Id:
1017
Official Gene Full Name:
Cyclin-dependent kinase 2
Protein Name:
Cyclin-dependent kinase 2
Swissprot Id:
P24941
Protein Accession #:
NP_001789
Nucleotide Accession #:
NM_001798
Alias Symbols:
p33(CDK2)
Replacement Item:
This antibody may replace item sc-136191 from Santa Cruz Biotechnology.
Description of Target:
Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.
Protein Size (# AA):
298
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDK2.
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CDK2 (ARP30331_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAPT; CDKN1A; CCNA2; VCP; SAMHD1; IMPDH2; CDK2; SKP1; FZR1; CKS2; CKS1B; CCNE2; GOLGA2; CREBBP; CDKN1C; CDKN1B; CCNE1; CDK13; SKP2; RBL2; RBL1; CCNB1; COPS5; PTMA; HIST1H1A; PRDX1; CCNJ; CDK7; CDK3; EP300; ATP1A1; MYBL2; MNAT1; HSPD1; HSP90AB1; HSP90AA1;
Blocking Peptide:
For anti-CDK2 (ARP30331_P050) antibody is Catalog # AAPP45995
Datasheets/Manuals:
Printable datasheet for anti-CDK2 (ARP30331_P050) antibody
Sample Type Confirmation:

CDK2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Publications:

Huang, CX; Chen, N; Wu, XJ; Huang, CH; He, Y; Tang, R; Wang, WM; Wang, HL; The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1α and functions in cellular adaptations. 29, 4901-13 (2015). WB, IHC, Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26265472

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...