Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP30331_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30331_P050-FITC Conjugated

ARP30331_P050-HRP Conjugated

ARP30331_P050-Biotin Conjugated

CDK2 Antibody - middle region (ARP30331_P050)

Catalog#: ARP30331_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-136191 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data Anti-CDK2 (ARP30331_P050)
Peptide Sequence Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CDK2 (ARP30331_P050) antibody is Catalog # AAPP45995
Datasheets/Manuals Printable datasheet for anti-CDK2 (ARP30331_P050) antibody
Sample Type Confirmation

CDK2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Publications

Huang, CX; Chen, N; Wu, XJ; Huang, CH; He, Y; Tang, R; Wang, WM; Wang, HL; The zebrafish miR-462/miR-731 cluster is induced under hypoxic stress via hypoxia-inducible factor 1α and functions in cellular adaptations. 29, 4901-13 (2015). WB, IHC, Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26265472

Gene Symbol CDK2
Official Gene Full Name Cyclin-dependent kinase 2
Alias Symbols p33(CDK2)
NCBI Gene Id 1017
Protein Name Cyclin-dependent kinase 2
Description of Target Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.
Swissprot Id P24941
Protein Accession # NP_001789
Nucleotide Accession # NM_001798
Protein Size (# AA) 298
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CDK2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CDK2.
Protein Interactions MAPT; CDKN1A; CCNA2; VCP; SAMHD1; IMPDH2; CDK2; SKP1; FZR1; CKS2; CKS1B; CCNE2; GOLGA2; CREBBP; CDKN1C; CDKN1B; CCNE1; CDK13; SKP2; RBL2; RBL1; CCNB1; COPS5; PTMA; HIST1H1A; PRDX1; CCNJ; CDK7; CDK3; EP300; ATP1A1; MYBL2; MNAT1; HSPD1; HSP90AB1; HSP90AA1;
Write Your Own Review
You're reviewing:CDK2 Antibody - middle region (ARP30331_P050)
Your Rating