CDK11A Antibody - C-terminal region (ARP61814_P050)

Catalog No: ARP61814_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-CDK11A Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Brain

Host: Rabbit
Target: CDK11A
Positive control (+): HeLa Cell Lysate (HL)
Negative control (-): MCF7 Cell Lysate (N10)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDK11A (ARP61814_P050) antibody is Catalog # AAP61814

Target Info

• Gene Symbol: CDK11A
• Gene Full Name: Cyclin-dependent kinase 11A
• Alias Symbols: CDC2L2, CDC2L3, p58GTA, PITSLRE, CDK11-p46, CDK11-p58, CDK11-p110
• NCBI Gene Id: 728642
• Protein Name: Cyclin-dependent kinase 11A
• Description of Target: This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far.
• Uniprot ID: Q9UQ88
• Protein Accession #: NP_277071
• Nucleotide Accession #: NM_033529
• Protein Size (# AA): 767
• Molecular Weight: 84kDa
• Protein Interactions: UBC; CDC37; FKBP5; PIN1; CDK11A; HKR1; C18orf25; RBM25; ZFP14; PRPF40A; NOP58; ZNF510; ZNF460; ZNF267; ZNF33A; PSMD1; KPNA2; KPNB1; CSNK2B; CSNK2A2; CSNK2A1; CDKN2A; A2M; SOX2; Dlg4; GADD45A; HSP90AA1; SMAD3; SUMO2; CCNL1; SRSF7; RNPS1; KAT7; PAK1; CASP8;