CDH7 Antibody - N-terminal region (ARP46435_P050)

Catalog No: ARP46435_P050

WB Suggested Anti-CDH7 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDH7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDH7 (ARP46435_P050) antibody is Catalog # AAP46435 (Previous Catalog # AAPS18301)
• Reference: Moore,R., (2004) Oncogene 23 (40), 6726-6735

Target Info

• Gene Symbol: CDH7
• Gene Full Name: Cadherin 7, type 2
• Alias Symbols: CDH7L1
• NCBI Gene Id: 1005
• Protein Name: Cadherin-7
• Description of Target: CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.This gene is a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures. Alternative splicing in the 5' UTR of this gene yields variant transcripts encoding the same protein.
• Uniprot ID: Q9ULB5
• Protein Accession #: NP_004352
• Nucleotide Accession #: NM_004361
• Protein Size (# AA): 785
• Molecular Weight: 82kDa
• Protein Interactions: FGF21; CDH9; CDH7; CDH12; CDH6; CTNNB1; CDH15;