Search Antibody, Protein, and ELISA Kit Solutions

CDH6 Antibody - N-terminal region : FITC (ARP73880_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73880_P050 Unconjugated

ARP73880_P050-HRP Conjugated

ARP73880_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CDH6
Official Gene Full Name:
cadherin 6
NCBI Gene Id:
1004
Protein Name:
cadherin-6
Swissprot Id:
P55285-2
Alias Symbols:
CAD6, KCAD
Description of Target:
This gene encodes a member of the cadherin superfamily. Cadherins are membrane glycoproteins that mediate homophilic cell-cell adhesion and play critical roles in cell differentiation and morphogenesis. The encoded protein is a type II cadherin and may play a role in kidney development as well as endometrium and placenta formation. Decreased expression of this gene may be associated with tumor growth and metastasis.
Protein Size (# AA):
663
Molecular Weight:
72kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDH6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDH6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CADH6
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: VIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CDH9; CDH7; CDH10; CDH18; CDH19; CDH6; CTNNB1;
Blocking Peptide:
For anti-CDH6 (ARP73880_P050-FITC) antibody is Catalog # AAP73880
Datasheets/Manuals:
Printable datasheet for anti-CDH6 (ARP73880_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...