Size:100 ul
$289.00
In Stock
SKU
ARP73880_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73880_P050 Unconjugated

ARP73880_P050-HRP Conjugated

ARP73880_P050-Biotin Conjugated

CDH6 Antibody - N-terminal region : FITC (ARP73880_P050-FITC)

Catalog#: ARP73880_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human CADH6
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: VIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CDH6 (ARP73880_P050-FITC) antibody is Catalog # AAP73880
Datasheets/ManualsPrintable datasheet for anti-CDH6 (ARP73880_P050-FITC) antibody
Gene SymbolCDH6
Official Gene Full Namecadherin 6
Alias SymbolsCAD6, KCAD
NCBI Gene Id1004
Protein Namecadherin-6
Description of TargetThis gene encodes a member of the cadherin superfamily. Cadherins are membrane glycoproteins that mediate homophilic cell-cell adhesion and play critical roles in cell differentiation and morphogenesis. The encoded protein is a type II cadherin and may play a role in kidney development as well as endometrium and placenta formation. Decreased expression of this gene may be associated with tumor growth and metastasis.
Swissprot IdP55285-2
Protein Size (# AA)663
Molecular Weight72kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CDH6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CDH6.
Protein InteractionsCDH9; CDH7; CDH10; CDH18; CDH19; CDH6; CTNNB1;
Write Your Own Review
You're reviewing:CDH6 Antibody - N-terminal region : FITC (ARP73880_P050-FITC)
Your Rating
Aviva Travel Grant
Aviva Blast Tool
Free Microscope
Aviva Live Chat