Search Antibody, Protein, and ELISA Kit Solutions

CDH5 Antibody - C-terminal region (ARP81377_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CDH5
Official Gene Full Name:
cadherin 5
NCBI Gene Id:
1003
Protein Name:
cadherin-5
Swissprot Id:
P33151-2
Protein Accession #:
NP_001786.2
Nucleotide Accession #:
NM_001795.3
Alias Symbols:
7B4, CD144
Description of Target:
This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer.
Protein Size (# AA):
669
Molecular Weight:
73 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDH5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDH5.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CDH5
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CDH5 (ARP81377_P050) antibody is Catalog # AAP81377
Datasheets/Manuals:
Printable datasheet for anti-CDH5 (ARP81377_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...