Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP81377_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CDH5 Antibody - C-terminal region (ARP81377_P050)

Catalog#: ARP81377_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CDH5
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: MIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CDH5 (ARP81377_P050) antibody is Catalog # AAP81377
Datasheets/ManualsPrintable datasheet for anti-CDH5 (ARP81377_P050) antibody
Gene SymbolCDH5
Official Gene Full Namecadherin 5
Alias Symbols7B4, CD144
NCBI Gene Id1003
Protein Namecadherin-5
Description of TargetThis gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer.
Swissprot IdP33151-2
Protein Accession #NP_001786.2
Nucleotide Accession #NM_001795.3
Protein Size (# AA)669
Molecular Weight73 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CDH5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CDH5.
Write Your Own Review
You're reviewing:CDH5 Antibody - C-terminal region (ARP81377_P050)
Your Rating
Aviva Travel Grant
Aviva ChIP Antibodies
Aviva Blast Tool
Aviva Tissue Tool