CDH-1 Recombinant Protein (White-rot fungus) (OPCA04576)

Catalog No: OPCA04576

Product Info

• Predicted Species Reactivity: Phanerochaete chrysosporium
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
• Protein Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 19-208 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Cellobiose dehydrogenase from Phanerochaete chrysosporium is encoded by two allelic variants.Li B., Nagalla S.R., Renganathan V.Appl. Environ. Microbiol. 63:796-799(1997)
• Gene Symbol: CDH-1
• Alias Symbols: Cellobiose-quinone oxidoreductase.
• Protein Name: Cellobiose dehydrogenase
• Description of Target: Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.
• Uniprot ID: Q01738
• Protein Size (# AA): Recombinant
• Molecular Weight: 22.3 kDa