Search Antibody, Protein, and ELISA Kit Solutions

CDCP1 Antibody - C-terminal region : FITC (ARP73783_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73783_P050 Unconjugated

ARP73783_P050-HRP Conjugated

ARP73783_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
CDCP1, TRASK, UNQ2486/PRO5773,
Replacement Item:
This antibody may replace item sc-292398 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a transmembrane protein which contains three extracellular CUB domains and acts as a substrate for Src family kinases. The protein plays a role in the tyrosine phosphorylation-dependent regulation of cellular events that are involved in tumor invasion and metastasis. Alternative splicing results in multiple transcript variants of this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDCP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDCP1.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDCP1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: ICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CDCP1 (ARP73783_P050-FITC) antibody is Catalog # AAP73783
Printable datasheet for anti-CDCP1 (ARP73783_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...