CDCP1 Antibody - C-terminal region (ARP73783_P050)

Catalog No: ARP73783_P050

Host: Rabbit
Target Name: CDCP1
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDCP1
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: ICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDCP1 (ARP73783_P050) antibody is Catalog # AAP73783

Target Info

• Gene Symbol: CDCP1
• Alias Symbols: CD318, TRASK, SIMA135
• NCBI Gene Id: 64866
• Description of Target: This gene encodes a transmembrane protein which contains three extracellular CUB domains and acts as a substrate for Src family kinases. The protein plays a role in the tyrosine phosphorylation-dependent regulation of cellular events that are involved in tumor invasion and metastasis. Alternative splicing results in multiple transcript variants of this gene.
• Uniprot ID: Q9H5V8-2
• Protein Size (# AA): 649
• Molecular Weight: 71kDa
• Protein Interactions: SDCBP; UBC; ALB; ST14; SRC; PRKCD; PLG;