Size:100 ul
$289.00
In Stock
SKU
AVARP01017_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP01017_P050 Unconjugated

AVARP01017_P050-HRP Conjugated

AVARP01017_P050-Biotin Conjugated

CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)

Catalog#: AVARP01017_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Dog, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB, IHC
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-34314 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42
Predicted Homology Based on Immunogen Sequence Dog: 100%; Rabbit: 100%
Peptide Sequence Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP
Concentration 0.5 mg/ml
Blocking Peptide For anti-CDC42 (AVARP01017_P050-FITC) antibody is Catalog # AAP30406 (Previous Catalog # AAPP00929)
Datasheets/Manuals Printable datasheet for anti-CDC42 (AVARP01017_P050-FITC) antibody
Sample Type Confirmation

CDC42 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Black,S.A. (2008) J. Biol. Chem. 283 (16), 10835-10847
Gene Symbol CDC42
Official Gene Full Name Cell division cycle 42 (GTP binding protein, 25kDa)
Alias Symbols CDC42Hs, G25K
NCBI Gene Id 998
Protein Name Cell division control protein 42 homolog
Description of Target CDC42 is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.
Swissprot Id P60953
Protein Accession # NP_001782
Nucleotide Accession # NM_001791
Protein Size (# AA) 191
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CDC42.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CDC42.
Protein Interactions PARD6B; CDC42EP1; CDC42EP2; PAK2; UBC; TRAF2; PAK1; ARHGDIA; BIRC2; TNK2; TCEB2; EPRS; LARS; RUVBL1; NEK6; WIPF1; WASL; RIOK3; SSX2IP; DIAPH3; BAIAP2; PAK3; ZNF420; IQGAP1; RAP1A; WAS; TGFBR2; TGFBR1; ARHGEF6; LRRK2; FGD3; ARHGAP1; SH3RF3; BCAR1; USP6; EL
  1. What is the species homology for "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Dog, Rabbit".

  2. How long will it take to receive "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    This target may also be called "CDC42Hs, G25K" in publications.

  5. What is the shipping cost for "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CDC42"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CDC42"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CDC42"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CDC42"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CDC42"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CDC42"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CDC42 Antibody - N-terminal region : FITC (AVARP01017_P050-FITC)
Your Rating