- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-CDC25C (AVARP03034_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CDC25C |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100%; Mouse: 91%; Rabbit: 83% |
Peptide Sequence | Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CDC25C (AVARP03034_P050) antibody is Catalog # AAP30150 (Previous Catalog # AAPP00307) |
Sample Type Confirmation | There is BioGPS gene expression data showing that CDC25C is expressed in Jurkat |
Reference | Bonnet,J., (2008) Biochem. Biophys. Res. Commun. 370 (3), 483-488 |
---|---|
Gene Symbol | CDC25C |
Gene Full Name | Cell division cycle 25 homolog C (S. pombe) |
Alias Symbols | CDC25, PPP1R60 |
NCBI Gene Id | 995 |
Protein Name | M-phase inducer phosphatase 3 |
Description of Target | CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. |
Uniprot ID | P30307 |
Protein Accession # | NP_073720 |
Nucleotide Accession # | NM_022809 |
Protein Size (# AA) | 400 |
Molecular Weight | 45kDa |
Protein Interactions | CDC37; UBC; HSP90AA1; HSPA4; YWHAB; YWHAQ; YWHAZ; YWHAH; YWHAG; YWHAE; PKN1; SFN; MAPK9; PLK1; CHEK1; CHEK2; CDS1; MARK3; BRSK2; CDK2; PCNA; Cdk1; USP17L2; MAPK3; MAPK1; BRSK1; LZTS1; PLK3; NEDD4; PIN1; MAPK14; TP53; HRAS; LCK; CCNB1; CCNA2; SRC; SP1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rabbit".
-
How long will it take to receive "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CDC25C Antibody - N-terminal region (AVARP03034_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
This target may also be called "CDC25, PPP1R60" in publications.
-
What is the shipping cost for "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "45kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CDC25C Antibody - N-terminal region (AVARP03034_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CDC25C"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CDC25C"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CDC25C"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CDC25C"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CDC25C"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CDC25C"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.