SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61309_P050
Price: $0.00
SKU
ARP61309_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP61309_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Guinea Pig: 85%; Horse: 77%; Human: 100%; Rabbit: 85%
Peptide SequenceSynthetic peptide located within the following region: VICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPA
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP61309 (Previous Catalog # AAPP47446)
Sample Type Confirmation

CD70 is supported by BioGPS gene expression data to be expressed in ACHN

Gene SymbolCD70
Gene Full NameCD70 molecule
Alias SymbolsCD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A
NCBI Gene Id970
Protein NameCD70 antigen
Description of TargetThe protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Uniprot IDP32970
Protein Accession #NP_001243
Nucleotide Accession #NM_001252
Protein Size (# AA)193
Molecular Weight21 kDa
Protein InteractionsUBC; CD27; ELAVL1;
  1. What is the species homology for "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD70 Antibody - N-terminal region (ARP61309_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    This target may also be called "CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A" in publications.

  5. What is the shipping cost for "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD70 Antibody - N-terminal region (ARP61309_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CD70"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD70"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD70"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD70"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD70"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD70"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD70 Antibody - N-terminal region (ARP61309_P050)
Your Rating
We found other products you might like!