SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60155_P050
Price: $0.00
SKU
ARP60155_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CD55 (ARP60155_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CD55
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Horse: 79%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: PGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD55 (ARP60155_P050) antibody is Catalog # AAP60155 (Previous Catalog # AAPP46367)
Gene SymbolCD55
Gene Full NameCD55 molecule, decay accelerating factor for complement (Cromer blood group)
Alias SymbolsCR, TC, DAF, CROM, CHAPLE
NCBI Gene Id1604
Protein NameComplement decay-accelerating factor
Description of TargetThis gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels.
Uniprot IDP08174
Protein Accession #NP_000565
Nucleotide Accession #NM_000574
Protein Size (# AA)381
Molecular Weight41kDa
Protein InteractionsUBC; NDUFB7; NDUFS7; TIMM50; INF2; SYNJ2BP; PTCD3; PTRH2; MRPL4; SLC25A24; RAB31; ZMPSTE24; PICALM; SLC12A4; SLC2A1; S100A10; MPV17; MAN2A1; GNAI3; ATP6V1E1; GPLD1; CD97; CD14; LCK; FYN; CD55; CR1;
  1. What is the species homology for "CD55 Antibody - middle region (ARP60155_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Horse".

  2. How long will it take to receive "CD55 Antibody - middle region (ARP60155_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD55 Antibody - middle region (ARP60155_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD55 Antibody - middle region (ARP60155_P050)"?

    This target may also be called "CR, TC, DAF, CROM, CHAPLE" in publications.

  5. What is the shipping cost for "CD55 Antibody - middle region (ARP60155_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD55 Antibody - middle region (ARP60155_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD55 Antibody - middle region (ARP60155_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD55 Antibody - middle region (ARP60155_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CD55"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD55"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD55"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD55"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD55"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD55"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD55 Antibody - middle region (ARP60155_P050)
Your Rating
We found other products you might like!