CD47 Antibody - N-terminal region (ARP63284_P050)

Catalog No: ARP63284_P050

WB Suggested Anti-CD47 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Horse: 100%; Human: 100%; Pig: 91%; Rabbit: 92%
• Peptide Sequence: Synthetic peptide located within the following region: FKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CD47 (ARP63284_P050) antibody is Catalog # AAP63284
• Publications:

  Nanoparticle biointerfacing by platelet membrane cloaking. Nature. 526, 118-21 (2015). 26374997

  Targeted gene silencing in vivo by platelet membrane-coated metal-organic framework nanoparticles. Sci Adv. 6, eaaz6108 (2020). 32258408

Target Info

• Gene Symbol: CD47
• Gene Full Name: CD47 molecule
• Alias Symbols: IAP, OA3, MER6
• NCBI Gene Id: 961
• Protein Name: Leukocyte surface antigen CD47
• Description of Target: This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: Q08722-3
• Protein Accession #: NP_001768
• Nucleotide Accession #: NM_001777
• Protein Size (# AA): 305
• Molecular Weight: 31kDa
• Protein Interactions: SYNE4; UBC; ELAVL1; UBQLN1; BNIP3; SIRPA; PTK2; P2RY2; ITGAV; THBS1; RHAG; EPB42; GNAI1; FAS; ITGB1;