SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF07534 (Formerly GWB-ASB378)
Size:100 ug
Price: $344.00
SKU
OAAF07534
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for CD45 Antibody (Phospho-Ser1007) (OAAF07534)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot
Additional InformationModification Sites: Human:S1007 Mouse:S996 Rat:S960
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human CD45 around the phosphorylation site of Ser1007.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: NRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVM
Concentration1mg/ml
SpecificityCD45 (Phospho-Ser1007) Antibody detects endogenous levels of CD45 only when phosphorylated at Ser1007.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
IF: 1:100~1:500
ELISA: 1:5000
Gene SymbolPTPRC
Gene Full Nameprotein tyrosine phosphatase receptor type C
Alias SymbolsB220;CD45;CD45 antigen;CD45R;GP180;LCA;L-CA;Leukocyte common antigen;LY5;protein tyrosine phosphatase, receptor type, c polypeptide;receptor-type tyrosine-protein phosphatase C;T200;T200 glycoprotein;T200 leukocyte common antigen.
NCBI Gene Id5788
Protein NameReceptor-type tyrosine-protein phosphatase C
Description of TargetProtein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Uniprot IDP08575
Molecular Weight147 kDa
  1. What is the species homology for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "CD45 Antibody (Phospho-Ser1007) (OAAF07534)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    This target may also be called "B220;CD45;CD45 antigen;CD45R;GP180;LCA;L-CA;Leukocyte common antigen;LY5;protein tyrosine phosphatase, receptor type, c polypeptide;receptor-type tyrosine-protein phosphatase C;T200;T200 glycoprotein;T200 leukocyte common antigen." in publications.

  5. What is the shipping cost for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "147 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTPRC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTPRC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTPRC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTPRC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTPRC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTPRC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD45 Antibody (Phospho-Ser1007) (OAAF07534)
Your Rating
We found other products you might like!