Size:100 ug
$299.00
In Stock
SKU
OAAF07534
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07534-FITC Conjugated

OAAF07534-HRP Conjugated

OAAF07534-Biotin Conjugated

CD45 Antibody (Phospho-Ser1007) (OAAF07534)

Catalog#: OAAF07534
Domestic: within 1 week delivery | International: 1 week
This product is Genway GWB-ASB378
More Information
Predicted Species Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Application WB, IF
Additional Information Modification Sites: Human:S1007 Mouse:S996 Rat:S960
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-1123 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human CD45 around the phosphorylation site of Ser1007.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide Sequence Synthetic peptide located within the following region: NRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVM
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF07534
Specificity CD45 (Phospho-Ser1007) Antibody detects endogenous levels of CD45 only when phosphorylated at Ser1007.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info WB: 1:500~1:1000
IF: 1:100~1:500
ELISA: 1:5000
Gene Symbol PTPRC
Alias Symbols L-CA, Leukocyte common antigen precursor, Leukocyte common antigen variant 4 precursor, LY-5, Lymphocyte common antigen Ly-5, PTPRC, T200
NCBI Gene Id 5788
Swissprot Id P08575
Molecular Weight 147 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PTPRC.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PTPRC.
  1. What is the species homology for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "CD45 Antibody (Phospho-Ser1007) (OAAF07534)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    This target may also be called "L-CA, Leukocyte common antigen precursor, Leukocyte common antigen variant 4 precursor, LY-5, Lymphocyte common antigen Ly-5, PTPRC, T200" in publications.

  5. What is the shipping cost for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "147 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD45 Antibody (Phospho-Ser1007) (OAAF07534)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PTPRC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTPRC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTPRC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTPRC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTPRC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTPRC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD45 Antibody (Phospho-Ser1007) (OAAF07534)
Your Rating
We found other products you might like!