Search Antibody, Protein, and ELISA Kit Solutions

CD45 Antibody (Phospho-Ser1007) (OAAF07534)

100 ug
$299.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF07534-FITC Conjugated

OAAF07534-HRP Conjugated

OAAF07534-Biotin Conjugated

Predicted Species Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IF
Additional Information:
Modification Sites: Human:S1007 Mouse:S996 Rat:S960
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Gene Symbol:
PTPRC
NCBI Gene Id:
5788
Swissprot Id:
P08575
Alias Symbols:
L-CA, Leukocyte common antigen precursor, Leukocyte common antigen variant 4 precursor, LY-5, Lymphocyte common antigen Ly-5, PTPRC, T200
Replacement Item:
This antibody may replace item sc-1123 from Santa Cruz Biotechnology.
Molecular Weight:
147 kDa
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PTPRC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PTPRC.
Immunogen:
The antiserum was produced against synthesized peptide derived from human CD45 around the phosphorylation site of Ser1007.
Peptide Sequence:
Synthetic peptide located within the following region: NRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVM
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF07534
Specificity:
CD45 (Phospho-Ser1007) Antibody detects endogenous levels of CD45 only when phosphorylated at Ser1007.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
IF: 1:100~1:500
ELISA: 1:5000

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...