CD40LG Antibody - middle region (ARP33831_P050)

Catalog No: ARP33831_P050

WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD40LG
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 92%; Rat: 85%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP33831 (Previous Catalog # AAPP04902)
• Reference: Huang,F.Y., (er) J. Clin. Immunol. (2008) In press
• Publications:

  IFNT-independent effects of intrauterine extracellular vesicles (EVs) in cattle. Reproduction. 159, 503-511 (2020) 32103820

• Description:
  View product citations for CD40LG Antibody - middle region (ARP33831_P050) on CiteAb

Target Info

• Gene Symbol: CD40LG
• Gene Full Name: CD40 ligand
• Alias Symbols: IGM, IMD3, TRAP, gp39, CD154, CD40L, HIGM1, T-BAM, TNFSF5, hCD40L
• NCBI Gene Id: 959
• Protein Name: CD40 ligand
• Description of Target: CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830
• Uniprot ID: P29965
• Protein Accession #: NP_000065
• Nucleotide Accession #: NM_000074
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: UBC; TRAF2; TRAF1; CD40; BIRC3; BIRC2; CRYAB; IGHG1; CD5L; CD40LG; TP53; IGKC; RNF128; HPR; APOA1;