Catalog No: OPCA04417
Price: $0.00
SKU
OPCA04417
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CD3G Recombinant Protein (Crab-eating macaque) (OPCA04417) (OPCA04417) |
---|
Predicted Species Reactivity | Cynomolgus Monkey|Macaca fascicularis |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
Protein Sequence | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 23-113 aa |
Tag | N-terminal 6xHis-tagged |
Reference | CD3 polymorphism in cynomolgus monkeys (Macaca fascicularis).Uda A., Tanabayashi K., Mukai R., Yachi M., Nam K., Yamada A.J. Med. Primatol. 30:141-147(2001) . |
---|---|
Gene Symbol | CD3G |
Gene Full Name | CD3g molecule |
Alias Symbols | CD3 gamma;CD3g molecule, epsilon (CD3-TCR complex);CD3g molecule, gamma (CD3-TCR complex);T-cell receptor T3 gamma chain;T-cell surface glycoprotein CD3 gamma chain. |
NCBI Gene Id | 102134381 |
Protein Name | T-cell surface glycoprotein CD3 gamma chain |
Description of Target | Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G. |
Uniprot ID | Q95LI7 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 12.5 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!