Search Antibody, Protein, and ELISA Kit Solutions

CD36 Antibody - N-terminal region (ARP48127_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48127_P050-FITC Conjugated

ARP48127_P050-HRP Conjugated

ARP48127_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-13572, HPA002018
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CD36
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-CD36 (ARP48127_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CD36 (ARP48127_P050) antibody is Catalog # AAP48127 (Previous Catalog # AAPP28011)
Datasheets/Manuals:
Printable datasheet for anti-CD36 (ARP48127_P050) antibody
Target Reference:
Bhr,C., (2008) Hum. Mol. Genet. 17 (11), 1695-1704
Gene Symbol:
CD36
Official Gene Full Name:
CD36 molecule (thrombospondin receptor)
Alias Symbols:
CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3, BDPLT10
NCBI Gene Id:
948
Protein Name:
Platelet glycoprotein 4
Description of Target:
CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency. The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Swissprot Id:
P16671
Protein Accession #:
NP_001001547
Nucleotide Accession #:
NM_001001547
Protein Size (# AA):
472
Molecular Weight:
53kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CD36.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CD36.
Protein Interactions:
CHRD; APP; CAND1; ITGA2B; MATK; SRC; THBS1; ITGB3; LYN; YES1; ITGA6; CD9; FYN; ITGB1; COL1A2; COL1A1; VLDLR; LDLR; HSD11B1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...