Size:100 ul
$319.00
In Stock
SKU
ARP48127_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48127_P050-FITC Conjugated

ARP48127_P050-HRP Conjugated

ARP48127_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13572, HPA002018
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CD36
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-CD36 (ARP48127_P050)
Peptide Sequence Synthetic peptide located within the following region: KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CD36 (ARP48127_P050) antibody is Catalog # AAP48127 (Previous Catalog # AAPP28011)
Datasheets/Manuals Printable datasheet for anti-CD36 (ARP48127_P050) antibody
Target Reference Bhr,C., (2008) Hum. Mol. Genet. 17 (11), 1695-1704
Gene Symbol CD36
Official Gene Full Name CD36 molecule (thrombospondin receptor)
Alias Symbols CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3, BDPLT10
NCBI Gene Id 948
Protein Name Platelet glycoprotein 4
Description of Target CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency. The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Swissprot Id P16671
Protein Accession # NP_001001547
Nucleotide Accession # NM_001001547
Protein Size (# AA) 472
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CD36.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CD36.
Protein Interactions CHRD; APP; CAND1; ITGA2B; MATK; SRC; THBS1; ITGB3; LYN; YES1; ITGA6; CD9; FYN; ITGB1; COL1A2; COL1A1; VLDLR; LDLR; HSD11B1;
  1. What is the species homology for "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD36 Antibody - N-terminal region (ARP48127_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    This target may also be called "CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3, BDPLT10" in publications.

  5. What is the shipping cost for "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD36 Antibody - N-terminal region (ARP48127_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CD36"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD36"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD36"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD36"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD36"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD36"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD36 Antibody - N-terminal region (ARP48127_P050)
Your Rating
We found other products you might like!