Catalog No: ARP63067_P050
Price: $0.00
SKU
ARP63067_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CD33 (ARP63067_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Horse: 79%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: HPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD33 (ARP63067_P050) antibody is Catalog # AAP63067
Gene SymbolCD33
Gene Full NameCD33 molecule
Alias Symbolsp67, SIGLEC3, SIGLEC-3
NCBI Gene Id945
Protein NameMyeloid cell surface antigen CD33
Description of TargetCD33 is a putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. CD33 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, CD33 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. CD33 induces apoptosis in acute myeloid leukemia (in vitro).
Uniprot IDP20138
Protein Accession #NP_001763
Nucleotide Accession #NM_001772
Protein Size (# AA)364
Molecular Weight38kDa
Protein InteractionsKRT40; KRT31; HERC3; UBC; CBL; SRC; PTPN6; PTPN11;
  1. What is the species homology for "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Horse".

  2. How long will it take to receive "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD33 Antibody - N-terminal region (ARP63067_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    This target may also be called "p67, SIGLEC3, SIGLEC-3" in publications.

  5. What is the shipping cost for "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD33 Antibody - N-terminal region (ARP63067_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CD33"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD33"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD33"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD33"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD33"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD33"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD33 Antibody - N-terminal region (ARP63067_P050)
Your Rating
We found other products you might like!