Search Antibody, Protein, and ELISA Kit Solutions

CD2BP2 Antibody - N-terminal region (ARP82373_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CD2BP2
Official Gene Full Name:
CD2 (cytoplasmic tail) binding protein 2
NCBI Gene Id:
10421
Protein Name:
CD2 antigen cytoplasmic tail-binding protein 2
Swissprot Id:
O95400
Protein Accession #:
NP_001230575.1
Nucleotide Accession #:
NM_001243646.1
Alias Symbols:
LIN1, Snu40, FWP010, U5-52K, PPP1R59
Description of Target:
This gene encodes a bi-functional protein. In the cytoplasm, the encoded protein binds the cytoplasmic tail of human surface antigen CD2 via its C-terminal GYF domain, and regulate CD2-triggered T lymphocyte activation. In the nucleus, this protein is a component of the U5 small nuclear ribonucleoprotein complex and is involved in RNA splicing. A pseudogene has been identified on chromosome 7. Alternative splicing results in multiple transcript variants but their biological validity has not been determined.
Protein Size (# AA):
341
Molecular Weight:
37 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CD2BP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CD2BP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CD2BP2
Peptide Sequence:
Synthetic peptide located within the following region: KHSLDSDEEEDDDDGGSSKYDILASEDVEGQEAATLPSEGGVRITPFNLQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CD2BP2 (ARP82373_P050) antibody is Catalog # AAP82373
Datasheets/Manuals:
Printable datasheet for anti-CD2BP2 (ARP82373_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...