Search Antibody, Protein, and ELISA Kit Solutions

CD27 Antibody - C-terminal region (ARP59093_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP59093_P050-FITC Conjugated

ARP59093_P050-HRP Conjugated

ARP59093_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CD27
Official Gene Full Name:
CD27 molecule
NCBI Gene Id:
939
Protein Name:
CD27 antigen
Swissprot Id:
P26842
Protein Accession #:
NP_001233
Nucleotide Accession #:
NM_001242
Alias Symbols:
MGC20393, S152, T14, TNFRSF7, Tp55
Replacement Item:
This antibody may replace item sc-1740 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
Protein Size (# AA):
260
Molecular Weight:
27kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CD27.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CD27.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CD27
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 75%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-CD27 (ARP59093_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRAF2; CD70; ELAVL1; UHRF2; SIVA1; TRAF5; TRAF3; TRAF1; CD5;
Blocking Peptide:
For anti-CD27 (ARP59093_P050) antibody is Catalog # AAP59093 (Previous Catalog # AAPP45081)
Datasheets/Manuals:
Printable datasheet for anti-CD27 (ARP59093_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...