Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP90385_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CD247 Antibody - middlel region (ARP90385_P050)

Catalog#: ARP90385_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CD247
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CD247 (ARP90385_P050) antibody is Catalog # AAP90385
Datasheets/Manuals Printable datasheet for anti-CD247 (ARP90385_P050) antibody
Gene Symbol CD247
Official Gene Full Name CD247 antigen
Alias Symbols Cd3, T3z, Cd3h, Cd3z, Tcrk, Tcrz, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, 4930549J05Rik, A430104F18Rik
NCBI Gene Id 12503
Protein Name CD247 antigen
Description of Target Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Swissprot Id P24161
Protein Accession # NP_001106862.1
Nucleotide Accession # NM_001113391.2
Protein Size (# AA) 164
Molecular Weight 18 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CD247.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CD247.
  1. What is the species homology for "CD247 Antibody - middlel region (ARP90385_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "CD247 Antibody - middlel region (ARP90385_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CD247 Antibody - middlel region (ARP90385_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD247 Antibody - middlel region (ARP90385_P050)"?

    This target may also be called "Cd3, T3z, Cd3h, Cd3z, Tcrk, Tcrz, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, 4930549J05Rik, A430104F18Rik" in publications.

  5. What is the shipping cost for "CD247 Antibody - middlel region (ARP90385_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD247 Antibody - middlel region (ARP90385_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD247 Antibody - middlel region (ARP90385_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD247 Antibody - middlel region (ARP90385_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CD247"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD247"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD247"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD247"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD247"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD247"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD247 Antibody - middlel region (ARP90385_P050)
Your Rating