Search Antibody, Protein, and ELISA Kit Solutions

CD247 Antibody - middlel region (ARP90385_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse CD247
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CD247 (ARP90385_P050) antibody is Catalog # AAP90385
Datasheets/Manuals:
Printable datasheet for anti-CD247 (ARP90385_P050) antibody
Gene Symbol:
CD247
Official Gene Full Name:
CD247 antigen
Alias Symbols:
Cd3, T3z, Cd3h, Cd3z, Tcrk, Tcrz, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, 4930549J05Rik, A430104F18Rik
NCBI Gene Id:
12503
Protein Name:
CD247 antigen
Description of Target:
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Swissprot Id:
P24161
Protein Accession #:
NP_001106862.1
Nucleotide Accession #:
NM_001113391.2
Protein Size (# AA):
164
Molecular Weight:
18 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CD247.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CD247.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...