CD226 Antibody - C-terminal region (ARP84183_P050)

Catalog No: ARP84183_P050

Host: Rabbit
Target Name: CD226
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD226
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: FTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CD226 (ARP84183_P050) antibody is Catalog # AAP84183

Target Info

• Gene Symbol: CD226
• Gene Full Name: CD226 molecule
• Alias Symbols: PTA1, DNAM1, DNAM-1, TLiSA1
• NCBI Gene Id: 10666
• Protein Name: CD226 antigen
• Description of Target: This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q15762
• Protein Accession #: NP_001290547.1
• Nucleotide Accession #: NM_001303618.1
• Protein Size (# AA): 336
• Molecular Weight: 35 kDa