Search Antibody, Protein, and ELISA Kit Solutions

CD1E Antibody - C-terminal region (ARP63420_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63420_P050-FITC Conjugated

ARP63420_P050-HRP Conjugated

ARP63420_P050-Biotin Conjugated

Gene Symbol:
CD1E
Official Gene Full Name:
CD1b molecule
NCBI Gene Id:
913
Protein Name:
T-cell surface glycoprotein CD1e, membrane-associated
Swissprot Id:
P15812-3
Replacement Item:
This antibody may replace item sc-103425 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined.
Protein Size (# AA):
290
Molecular Weight:
31kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CD1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CD1B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD1E
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%; Sheep: 79%
Complete computational species homology data:
Anti-CD1B (ARP63420_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; B2M;
Blocking Peptide:
For anti-CD1E (ARP63420_P050) antibody is Catalog # AAP63420
Datasheets/Manuals:
Printable datasheet for anti-CD1E (ARP63420_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...