CD1B Antibody - middle region (ARP84323_P050)

Catalog No: ARP84323_P050

Host: Rabbit
Target Name: CD1B
Sample Tissue: Human Neurofibroma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD1B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CD1B (ARP84323_P050) antibody is Catalog # AAP84323

Target Info

• Gene Symbol: CD1B
• Gene Full Name: CD1b molecule
• Alias Symbols: R1, CD1, CD1A
• NCBI Gene Id: 910
• Protein Name: T-cell surface glycoprotein CD1b
• Description of Target: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.
• Uniprot ID: P29016
• Protein Accession #: NP_001755.1
• Nucleotide Accession #: NM_001764.2
• Protein Size (# AA): 333
• Molecular Weight: 36 kDa