CCT8 Antibody - C-terminal region : HRP (ARP45837_P050-HRP)

Catalog No: ARP45837_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCT8 (ARP45837_P050-HRP) antibody is Catalog # AAP45837 (Previous Catalog # AAPP26773)
• Sample Type Confirmation:

  CCT8 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

• Subunit: theta
• Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast, Rat, Dog, Horse, Bovine, Guinea pig, Mouse, Zebrafish 23103828

Target Info

• Gene Symbol: CCT8
• Gene Full Name: Chaperonin containing TCP1, subunit 8 (theta)
• Alias Symbols: Cctq, PRED71, D21S246, C21orf112
• NCBI Gene Id: 10694
• Protein Name: T-complex protein 1 subunit theta
• Description of Target: As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
• Uniprot ID: Q5RAP1
• Protein Accession #: NP_006576
• Nucleotide Accession #: NM_006585
• Protein Size (# AA): 548
• Molecular Weight: 59kDa
• Protein Interactions: FUS; HUWE1; UBC; TP53; TUBG1; SUMO3; LGALS3BP; NEDD1; CDC20; SUMO1; NEDD8; MDM2; ASB13; CCT5; CCT2; CCT7; CCT6A; FBXO6; UBD; FBXW4; HDAC3; STK24; ILK; CDK9; CDK5; CDK2; PAN2; FN1; METTL21B; TP63; VCAM1; PEX14; NOS2; ITGA4; US3; FAM86B2; METTL20; METTL18;