Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP45837_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45837_P050-FITC Conjugated

ARP45837_P050-HRP Conjugated

ARP45837_P050-Biotin Conjugated

CCT8 Antibody - C-terminal region (ARP45837_P050)

Catalog#: ARP45837_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-13891 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-CCT8 (ARP45837_P050)
Peptide SequenceSynthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CCT8 (ARP45837_P050) antibody is Catalog # AAP45837 (Previous Catalog # AAPP26773)
Datasheets/ManualsPrintable datasheet for anti-CCT8 (ARP45837_P050) antibody
Sample Type Confirmation

CCT8 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Subunittheta
Target ReferenceSuzuki,Y., Gene 200 (1-2), 149-156 (1997)
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish 23103828

Gene SymbolCCT8
Official Gene Full NameChaperonin containing TCP1, subunit 8 (theta)
Alias SymbolsCctq, D21S246, KIAA0002, PRED71, C21orf112
NCBI Gene Id10694
Protein NameT-complex protein 1 subunit theta
Description of TargetAs a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Swissprot IdQ5RAP1
Protein Accession #NP_006576
Nucleotide Accession #NM_006585
Protein Size (# AA)548
Molecular Weight59kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CCT8.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CCT8.
Protein InteractionsFUS; HUWE1; UBC; TP53; TUBG1; SUMO3; LGALS3BP; NEDD1; CDC20; SUMO1; NEDD8; MDM2; ASB13; CCT5; CCT2; CCT7; CCT6A; FBXO6; UBD; FBXW4; HDAC3; STK24; ILK; CDK9; CDK5; CDK2; PAN2; FN1; METTL21B; TP63; VCAM1; PEX14; NOS2; ITGA4; US3; FAM86B2; METTL20; METTL18;
Write Your Own Review
You're reviewing:CCT8 Antibody - C-terminal region (ARP45837_P050)
Your Rating
Assay Development
Aviva Travel Grant
Aviva Live Chat
Aviva Tips and Tricks