Search Antibody, Protein, and ELISA Kit Solutions

CCT8 antibody - C-terminal region (ARP45837_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45837_P050-FITC Conjugated

ARP45837_P050-HRP Conjugated

ARP45837_P050-Biotin Conjugated

Gene Symbol:
CCT8
NCBI Gene Id:
10694
Official Gene Full Name:
Chaperonin containing TCP1, subunit 8 (theta)
Protein Name:
T-complex protein 1 subunit theta
Swissprot Id:
Q5RAP1
Protein Accession #:
NP_006576
Nucleotide Accession #:
NM_006585
Alias Symbols:
Cctq, D21S246, KIAA0002, PRED71, C21orf112
Replacement Item:
This antibody may replace item sc-13891 from Santa Cruz Biotechnology.
Description of Target:
As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Protein Size (# AA):
548
Molecular Weight:
59kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCT8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCT8.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CCT8 (ARP45837_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; HUWE1; UBC; TP53; TUBG1; SUMO3; LGALS3BP; NEDD1; CDC20; SUMO1; NEDD8; MDM2; ASB13; CCT5; CCT2; CCT7; CCT6A; FBXO6; UBD; FBXW4; HDAC3; STK24; ILK; CDK9; CDK5; CDK2; PAN2; FN1; METTL21B; TP63; VCAM1; PEX14; NOS2; ITGA4; US3; FAM86B2; METTL20; METTL18;
Blocking Peptide:
For anti-CCT8 (ARP45837_P050) antibody is Catalog # AAP45837 (Previous Catalog # AAPP26773)
Datasheets/Manuals:
Printable datasheet for anti-CCT8 (ARP45837_P050) antibody
Sample Type Confirmation:

CCT8 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Subunit:
theta
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...