CCT6B Antibody - N-terminal region (ARP53660_P050)

Catalog No: ARP53660_P050

WB Suggested Anti-CCT6B Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate

WB Suggested Anti-CCT4 Antibody Titration: 1 ug/ml
Lane 1: 10ug of HEK293CCT6B is supported by BioGPS gene expression data to be expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCT6B (ARP53660_P050) antibody is Catalog # AAP53660 (Previous Catalog # AAPP30810)
• Sample Type Confirmation:

  CCT6B is supported by BioGPS gene expression data to be expressed in HEK293T

• Subunit: zeta-2
• Reference: Stirling,P.C., (2006) J. Biol. Chem. 281 (11), 7012-7021

Target Info

• Gene Symbol: CCT6B
• Gene Full Name: Chaperonin containing TCP1, subunit 6B (zeta 2)
• Alias Symbols: Cctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2
• NCBI Gene Id: 10693
• Protein Name: T-complex protein 1 subunit zeta-2
• Description of Target: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
• Uniprot ID: Q92526
• Protein Accession #: NP_006575
• Nucleotide Accession #: NM_006584
• Protein Size (# AA): 530
• Molecular Weight: 58kDa
• Protein Interactions: UBC; FAM86B2; METTL18; METTL21B; PAXIP1; CCT5; CCT2; CCT4; CCT3; TCP1; EIF4B; UBASH3B; FBXW8; PPP2R2D; STRN;