Catalog No: ARP53660_P050
Price: $0.00
SKU
ARP53660_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CCT6B (ARP53660_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CCT6B (ARP53660_P050) antibody is Catalog # AAP53660 (Previous Catalog # AAPP30810)
Sample Type Confirmation

CCT6B is supported by BioGPS gene expression data to be expressed in HEK293T

Subunitzeta-2
ReferenceStirling,P.C., (2006) J. Biol. Chem. 281 (11), 7012-7021
Gene SymbolCCT6B
Gene Full NameChaperonin containing TCP1, subunit 6B (zeta 2)
Alias SymbolsCctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2
NCBI Gene Id10693
Protein NameT-complex protein 1 subunit zeta-2
Description of TargetCCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Uniprot IDQ92526
Protein Accession #NP_006575
Nucleotide Accession #NM_006584
Protein Size (# AA)530
Molecular Weight58kDa
Protein InteractionsUBC; FAM86B2; METTL18; METTL21B; PAXIP1; CCT5; CCT2; CCT4; CCT3; TCP1; EIF4B; UBASH3B; FBXW8; PPP2R2D; STRN;
  1. What is the species homology for "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCT6B Antibody - N-terminal region (ARP53660_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    This target may also be called "Cctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2" in publications.

  5. What is the shipping cost for "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCT6B Antibody - N-terminal region (ARP53660_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCT6B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCT6B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCT6B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCT6B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCT6B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCT6B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCT6B Antibody - N-terminal region (ARP53660_P050)
Your Rating