CCRL2 Antibody - N-terminal region (ARP34023_P050)

Catalog No: ARP34023_P050

WB Suggested Anti-CCRL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysateCCRL2 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCRL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 90%; Rat: 82%
• Peptide Sequence: Synthetic peptide located within the following region: LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCRL2 (ARP34023_P050) antibody is Catalog # AAPP05103
• Sample Type Confirmation:

  CCRL2 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Galligan,C.L., (2004) Arthritis Rheum. 50 (6), 1806-1814

Target Info

• Gene Symbol: CCRL2
• Gene Full Name: Chemokine (C-C motif) receptor-like 2
• Alias Symbols: HCR, CKRX, CRAM, ACKR5, CRAM-A, CRAM-B
• NCBI Gene Id: 9034
• Protein Name: C-C chemokine receptor-like 2
• Description of Target: CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located.This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located.
• Uniprot ID: O00421
• Protein Accession #: NP_003956
• Nucleotide Accession #: NM_003965
• Protein Size (# AA): 344
• Molecular Weight: 39kDa