Search Antibody, Protein, and ELISA Kit Solutions

CCRL1 Antibody - C-terminal region (ARP62100_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62100_P050-FITC Conjugated

ARP62100_P050-HRP Conjugated

ARP62100_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ACKR4
Official Gene Full Name:
Chemokine (C-C motif) receptor-like 1
NCBI Gene Id:
51554
Protein Name:
C-C chemokine receptor type 11
Swissprot Id:
Q9NPB9
Protein Accession #:
NP_057641
Nucleotide Accession #:
NM_016557
Alias Symbols:
CC-CKR-11, CCBP2, CCR10, CCR11, CCX-CKR, CKR-11, PPR1, VSHK1, CCR-11, CCX CKR, CCRL1
Description of Target:
The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. Alternatively spliced transcript variants encoding the same protein have been described.
Protein Size (# AA):
350
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCRL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCRL1.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-CCRL1 (ARP62100_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CDK2; CXCL13; CCL21; CCL25; CCL8; CCL19; CCL13; CCL11; CCL5; CCL7; CCL2;
Blocking Peptide:
For anti-ACKR4 (ARP62100_P050) antibody is Catalog # AAP62100
Datasheets/Manuals:
Printable datasheet for anti-ACKR4 (ARP62100_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...