CCR8 Antibody - middle region : HRP (AVARP09059_T100-HRP)

Catalog No: AVARP09059_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Cow, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCR8
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Human: 100%; Rabbit: 81%
• Peptide Sequence: Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCR8 (AVARP09059_T100-HRP) antibody is Catalog # AAP30774 (Previous Catalog # AAPP01437)
• Sample Type Confirmation:

  CCR8 is supported by BioGPS gene expression data to be expressed in K562

• Reference: Haque,N.S., et al., (2004) Blood 103 (4), 1296-1304

Target Info

• Gene Symbol: CCR8
• Gene Full Name: Chemokine (C-C motif) receptor 8
• Alias Symbols: CY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, CMKBRL2, CC-CKR-8
• NCBI Gene Id: 1237
• Protein Name: C-C chemokine receptor type 8
• Description of Target: CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
• Uniprot ID: P51685
• Protein Accession #: NP_005192
• Nucleotide Accession #: NM_005201
• Protein Size (# AA): 355
• Molecular Weight: 41kDa
• Protein Interactions: TPST2; TPST1; CCR8; CCL17; CCL16; CCL4; CCL1;