Loading...
Catalog No: AVARP09059_T100
Price: $0.00
SKU
AVARP09059_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CCR8 (AVARP09059_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CCR8
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Human: 100%; Rabbit: 81%
Peptide SequenceSynthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
Concentration1.0 mg/ml
Blocking PeptideFor anti-CCR8 (AVARP09059_T100) antibody is Catalog # AAP30774 (Previous Catalog # AAPP01437)
Sample Type Confirmation

CCR8 is supported by BioGPS gene expression data to be expressed in K562

ReferenceHaque,N.S., et al., (2004) Blood 103 (4), 1296-1304
Gene SymbolCCR8
Gene Full NameChemokine (C-C motif) receptor 8
Alias SymbolsCY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, CMKBRL2, CC-CKR-8
NCBI Gene Id1237
Protein NameC-C chemokine receptor type 8
Description of TargetCCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
Uniprot IDP51685
Protein Accession #NP_005192
Nucleotide Accession #NM_005201
Protein Size (# AA)355
Molecular Weight41kDa
Protein InteractionsTPST2; TPST1; CCR8; CCL17; CCL16; CCL4; CCL1;
  1. What is the species homology for "CCR8 Antibody - middle region (AVARP09059_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Rabbit".

  2. How long will it take to receive "CCR8 Antibody - middle region (AVARP09059_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCR8 Antibody - middle region (AVARP09059_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCR8 Antibody - middle region (AVARP09059_T100)"?

    This target may also be called "CY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, CMKBRL2, CC-CKR-8" in publications.

  5. What is the shipping cost for "CCR8 Antibody - middle region (AVARP09059_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCR8 Antibody - middle region (AVARP09059_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCR8 Antibody - middle region (AVARP09059_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCR8 Antibody - middle region (AVARP09059_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCR8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCR8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCR8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCR8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCR8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCR8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCR8 Antibody - middle region (AVARP09059_T100)
Your Rating
We found other products you might like!