SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF08144
Size:100 ug
Price: $344.00
SKU
OAAF08144
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for CCR3 Antibody (OAAF08144)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from the N-terminal region of human CCR3.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLL
Concentration1mg/ml
SpecificityCCR3 Antibody detects endogenous levels of CCR3 protein.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
ELISA: 1:10000
Gene SymbolCCR3
Gene Full NameC-C motif chemokine receptor 3
Alias Symbolsb-chemokine receptor;C C CKR3;CC chemokine receptor 3;C-C chemokine receptor type 3;C-C CKR-3;CC-CKR-3;CCR-3;CD193;chemokine (C-C motif) receptor 3;CKR 3;CKR3;CMKBR3;eosinophil CC chemokine receptor 3;eosinophil eotaxin receptor.
NCBI Gene Id1232
Protein NameC-C chemokine receptor type 3
Description of TargetReceptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.
Uniprot IDP51677
Molecular Weight41 kDa
  1. What is the species homology for "CCR3 Antibody (OAAF08144)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "CCR3 Antibody (OAAF08144)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "CCR3 Antibody (OAAF08144)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCR3 Antibody (OAAF08144)"?

    This target may also be called "b-chemokine receptor;C C CKR3;CC chemokine receptor 3;C-C chemokine receptor type 3;C-C CKR-3;CC-CKR-3;CCR-3;CD193;chemokine (C-C motif) receptor 3;CKR 3;CKR3;CMKBR3;eosinophil CC chemokine receptor 3;eosinophil eotaxin receptor." in publications.

  5. What is the shipping cost for "CCR3 Antibody (OAAF08144)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCR3 Antibody (OAAF08144)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCR3 Antibody (OAAF08144)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCR3 Antibody (OAAF08144)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCR3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCR3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCR3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCR3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCR3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCR3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCR3 Antibody (OAAF08144)
Your Rating
We found other products you might like!