CCR10 Antibody - middle region (ARP63519_P050)

Catalog No: ARP63519_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: CCR10
Sample Type: Fetal Liver
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 86%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: ARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCR10 (ARP63519_P050) antibody is Catalog # AAP63519

Target Info

• Gene Symbol: CCR10
• Gene Full Name: Chemokine (C-C motif) receptor 10
• Alias Symbols: GPR2
• NCBI Gene Id: 2826
• Protein Name: C-C chemokine receptor type 10
• Description of Target: Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27; CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation.
• Uniprot ID: P46092
• Protein Accession #: NP_057686
• Nucleotide Accession #: NM_016602
• Protein Size (# AA): 362
• Molecular Weight: 40kDa
• Protein Interactions: CCL28; CXCL13; CCL27; CCL25; CCL19; CCR7; CCL7; CCL2; PRRC2A; CCL21;