Catalog No: AVARP03021_P050-HRP
Size:100ul
Price: $434.00
SKU
AVARP03021_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-CCNT1 (AVARP03021_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CCNT1
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CCNT1 (AVARP03021_P050-HRP) antibody is Catalog # AAP30172 (Previous Catalog # AAPS08904)
Sample Type Confirmation

CCNT1 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, MCF7

ReferenceSun,J., (2008) J. Virol. 82 (11), 5562-5572
Gene SymbolCCNT1
Gene Full NameCyclin T1
Alias SymbolsCCNT, CYCT1, HIVE1
NCBI Gene Id904
Protein NameCyclin-T1
Description of TargetCCNT1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO60563
Protein Accession #NP_001231
Nucleotide Accession #NM_001240
Protein Size (# AA)726
Molecular Weight81kDa
Protein Interactionstat; LARP7; AFF1; CDK9; BRD4; HEXIM1; UBC; SUMO1; NEDD8; RN7SK; SUPT5H; SOX2; CTD; MBP; AFF4; ELL2; MED26; MLLT3; ESR1; DAB2; CCNT1; BRDT; BARD1; TAF1; RPS9; GNAI3; LEO1; C11orf58; TUBB4B; TP53BP1; KMT2A; UBE2A; POLR2A; GTF2F1; TAF7; Ep300; Gata4; TERF2;
  1. What is the species homology for "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    This target may also be called "CCNT, CYCT1, HIVE1" in publications.

  5. What is the shipping cost for "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "81kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCNT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCNT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCNT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCNT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCNT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCNT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP)
Your Rating
We found other products you might like!