SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100991_P050
Price: $0.00
SKU
P100991_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CCNH (P100991_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CCNH
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 78%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CCNH (P100991_P050) antibody is Catalog # AAP31338 (Previous Catalog # AAPP02089)
ReferenceLi,Y., (2007) Lung Cancer 58 (2), 171-183
Gene SymbolCCNH
Gene Full NameCyclin H
Alias SymbolsCAK, p34, p37, CycH
NCBI Gene Id902
Protein NameCyclin-H
Description of TargetCCNH belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP51946
Protein Accession #NP_001230
Nucleotide Accession #NM_001239
Protein Size (# AA)323
Molecular Weight38kDa
Protein InteractionsSFN; GOLGA2; SSX2IP; CCDC170; CCDC33; DUSP12; SSSCA1; NDC80; CALCOCO2; PPFIA1; PSMA1; KLC3; RPA3; RPA2; RPA1; NEDD4; CDK7; CDK8; CDK2; CCNC; MNAT1; MBP; CTD; CDK20; CTBP2; CSNK2B; TRIM8; GANAB; RARB; POLR2A; GTF2H4; ERCC2; tat; POLR2B; CDK9; BRCA1; GTF2H1
  1. What is the species homology for "CCNH Antibody - middle region (P100991_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CCNH Antibody - middle region (P100991_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCNH Antibody - middle region (P100991_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCNH Antibody - middle region (P100991_P050)"?

    This target may also be called "CAK, p34, p37, CycH" in publications.

  5. What is the shipping cost for "CCNH Antibody - middle region (P100991_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCNH Antibody - middle region (P100991_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCNH Antibody - middle region (P100991_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCNH Antibody - middle region (P100991_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCNH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCNH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCNH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCNH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCNH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCNH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCNH Antibody - middle region (P100991_P050)
Your Rating
We found other products you might like!