Search Antibody, Protein, and ELISA Kit Solutions

CCNE2 Antibody - N-terminal region (ARP88222_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CCNE2
Official Gene Full Name:
cyclin E2
NCBI Gene Id:
9134
Protein Name:
G1/S-specific cyclin-E2
Swissprot Id:
O96020-2
Protein Accession #:
NP_477097.1
Nucleotide Accession #:
NM_057749.2
Alias Symbols:
CYCE2
Description of Target:
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells.
Protein Size (# AA):
359
Molecular Weight:
39 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCNE2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCNE2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNE2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CCNE2 (ARP88222_P050) antibody is Catalog # AAP88222
Datasheets/Manuals:
Printable datasheet for anti-CCNE2 (ARP88222_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...