CCNE2 Antibody - N-terminal region (ARP88222_P050)

Catalog No: ARP88222_P050

Host: Rabbit
Target Name: CCNE2
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCNE2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCNE2 (ARP88222_P050) antibody is Catalog # AAP88222

Target Info

• Gene Symbol: CCNE2
• Gene Full Name: cyclin E2
• Alias Symbols: CYCE2
• NCBI Gene Id: 9134
• Protein Name: G1/S-specific cyclin-E2
• Description of Target: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells.
• Uniprot ID: O96020-2
• Protein Accession #: NP_477097.1
• Nucleotide Accession #: NM_057749.2
• Protein Size (# AA): 359
• Molecular Weight: 39 kDa