Search Antibody, Protein, and ELISA Kit Solutions

CCNDBP1 Antibody - middle region (ARP55415_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55415_P050-FITC Conjugated

ARP55415_P050-HRP Conjugated

ARP55415_P050-Biotin Conjugated

Gene Symbol:
CCNDBP1
Official Gene Full Name:
Cyclin D-type binding-protein 1
NCBI Gene Id:
23582
Swissprot Id:
O95273
Protein Accession #:
NP_411241
Nucleotide Accession #:
NM_037370
Alias Symbols:
DIP1, GCIP, HHM
Replacement Item:
This antibody may replace item sc-145361 from Santa Cruz Biotechnology.
Description of Target:
This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene.
Protein Size (# AA):
232
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCNDBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCNDBP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-CCNDBP1 (ARP55415_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TYMSOS; ZNRF2P1; C6orf226; FAM74A4; ZNF564; ZNF555; TMEM120B; TRAPPC5; RPL39L; ZNF670; NEURL3; ZNF697; ZNF439; C22orf23; ZGPAT; ZNF394; RBP5; FAM110A; THAP7; TTC23; DMRT3; ARHGAP22; CCDC146; ZNF490; THAP10; IMP3; FAM64A; ZNF581; MRPL15; CNNM3; SYF2; NUDCD
Blocking Peptide:
For anti-CCNDBP1 (ARP55415_P050) antibody is Catalog # AAP55415 (Previous Catalog # AAPP44423)
Datasheets/Manuals:
Printable datasheet for anti-CCNDBP1 (ARP55415_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...