Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP55415_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP55415_P050-FITC Conjugated

ARP55415_P050-HRP Conjugated

ARP55415_P050-Biotin Conjugated

CCNDBP1 Antibody - middle region (ARP55415_P050)

Catalog#: ARP55415_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-145361 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92%
Complete computational species homology dataAnti-CCNDBP1 (ARP55415_P050)
Peptide SequenceSynthetic peptide located within the following region: NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CCNDBP1 (ARP55415_P050) antibody is Catalog # AAP55415 (Previous Catalog # AAPP44423)
Datasheets/ManualsPrintable datasheet for anti-CCNDBP1 (ARP55415_P050) antibody
Gene SymbolCCNDBP1
Official Gene Full NameCyclin D-type binding-protein 1
Alias SymbolsDIP1, GCIP, HHM
NCBI Gene Id23582
Description of TargetThis gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene.
Swissprot IdO95273
Protein Accession #NP_411241
Nucleotide Accession #NM_037370
Protein Size (# AA)232
Molecular Weight26kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CCNDBP1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CCNDBP1.
Protein InteractionsTYMSOS; ZNRF2P1; C6orf226; FAM74A4; ZNF564; ZNF555; TMEM120B; TRAPPC5; RPL39L; ZNF670; NEURL3; ZNF697; ZNF439; C22orf23; ZGPAT; ZNF394; RBP5; FAM110A; THAP7; TTC23; DMRT3; ARHGAP22; CCDC146; ZNF490; THAP10; IMP3; FAM64A; ZNF581; MRPL15; CNNM3; SYF2; NUDCD
Write Your Own Review
You're reviewing:CCNDBP1 Antibody - middle region (ARP55415_P050)
Your Rating
Aviva Live Chat
Free Microscope
Aviva Travel Grant
Aviva Validation Data