SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63410_P050
Price: $0.00
SKU
ARP63410_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CCNB2 (ARP63410_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: IGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLA
Concentration0.5 mg/ml
Blocking PeptideFor anti-CCNB2 (ARP63410_P050) antibody is Catalog # AAP63410
Gene SymbolCCNB2
Gene Full NameCyclin B2
Alias SymbolsHsT17299
NCBI Gene Id9133
Protein NameG2/mitotic-specific cyclin-B2
Description of TargetCyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
Uniprot IDO95067
Protein Accession #NP_004692
Nucleotide Accession #NM_004701
Protein Size (# AA)398
Molecular Weight45kDa
Protein InteractionsCKS2; CKS1B; CDK1; CDK2; MCM2; CDKN1A; ATR; UBC; tat; TSPYL2; TGFBR2;
  1. What is the species homology for "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCNB2 Antibody - N-terminal region (ARP63410_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    This target may also be called "HsT17299" in publications.

  5. What is the shipping cost for "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCNB2 Antibody - N-terminal region (ARP63410_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCNB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCNB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCNB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCNB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCNB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCNB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCNB2 Antibody - N-terminal region (ARP63410_P050)
Your Rating
We found other products you might like!