CCN5 Recombinant Protein (Mouse) (OPCA02559)

Catalog No: OPCA02559

Wisp2 Recombinant Protein (Mouse) (OPCA02559) in SDS-PAGE showing the molecular weight of approximately 40.5 kDa.

Wisp2 Recombinant Protein (Mouse) (OPCA02559) in SDS-PAGE showing the molecular weight of approximately 40.5 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Host: Mouse
• Additional Information: Relevance: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production .
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
• Protein Sequence: QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 24-251 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Identification and cloning of a connective tissue growth factor-like cDNA from human osteoblasts encoding a novel regulator of osteoblast functions.Kumar S., Hand A.T., Connor J.R., Dodds R.A., Ryan P.J., Trill J.J., Fisher S.M., Nuttall M.E., Lipshutz D.B., Zou C., Hwang S.M., Votta B.J., James I.E., Rieman D.J., Gowen M., Lee J.C.J. Biol. Chem. 274:17123-17131(1999)

Target Info

• Gene Symbol: Ccn5
• Gene Full Name: cellular communication network factor 5
• Alias Symbols: CCN;CCN family member 5;connective tissue growth factor-like protein;Crg;Crgr4;Ctgfl;CTGF-L;rC;Rcop1;Wi;Wisp2;WISP-2;WNT1 inducible signaling pathway protein 2.
• NCBI Gene Id: 22403
• Protein Name: WNT1-inducible-signaling pathway protein 2
• Description of Target: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).
• Uniprot ID: Q9Z0G4
• Protein Accession #: NP_058569.2
  
• Nucleotide Accession #: NM_016873.2
• Protein Size (# AA): Recombinant
• Molecular Weight: 40.5 kDa