CCL8 Recombinant Protein (Human) (OPCA03823)

Catalog No: OPCA03823

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• Protein Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 24-99 aa
• Tag: N-terminal GST-tagged
• Reference: Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.Blaszczyk J., Coillie E.V., Proost P., Damme J.V., Opdenakker G., Bujacz G.D., Wang J.M., Ji X.Biochemistry 39:14075-14081(2000)

Target Info

• Gene Symbol: CCL8
• Gene Full Name: C-C motif chemokine ligand 8
• Alias Symbols: C-C motif chemokine 8;chemokine (C-C motif) ligand 8;HC14;MCP2;MCP-2;monocyte chemoattractant protein 2;monocyte chemotactic protein 2;SCYA10;SCYA8;small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2);small-inducible cytokine A8.
• NCBI Gene Id: 6355
• Protein Name: C-C motif chemokine 8
• Description of Target: Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
• Uniprot ID: P80075
• Protein Accession #: NP_005614
• Nucleotide Accession #: NM_005623
• Protein Size (# AA): Recombinant
• Molecular Weight: 35.9 kDa