CCL5 Protein (OPCB00005)

Catalog No: OPCB00005

Size:2ug

Migration Assay

Product Info

• Product Format: Lyophilized
• Application: CA
• Additional Information: Extinction Coefficient: 12570 M-1 cm-1
  Endotoxin Level: <0.01 EU per 1ug of the protein by the LAL method
• Reconstitution and Storage: Spin tube prior to resuspending. Recommended at 100ug/mL in sterile water
  Shipping: Room Temp
• Purity: > 97% as determined by SDS-PAGE
• Biological Activity: EC50 = 0.13nM determined by Migration Assay in cells expressing recombinant CCR5
• Protein Sequence: The protein sequence is: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
• Source: E. coli
• Reference: 1. "RANTES: a versatile and controversial chemokine"
  Appay V., Rowland-Jones S.L.
  Trends Immunol 22:83-87 (2001)
  2. "Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells"
  Cocchi F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P.
  Science 270:1811-1815 (1995)
  3. A human T cell-specific molecule is a member of a new gene family
  Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M.
  J Immunol 141:1018-1025 (1988)
  4. "Engineering the glycosaminoglycan-binding affinity, kinetics and oligomerization behavior of RANTES: a tool for generating chemokine-based glycosaminoglycan antagonists"
  Brandner B., Rek A., Diedrichs-Möhring M., Wildner G., Kungl A.J.
  Protein Eng Des Sel. 22:367-373 (2009)

Target Info

• Gene Symbol: CCL5
• Gene Full Name: chemokine (C-C motif) ligand 5
• Alias Symbols: SISd, eoCP, SCYA5, RANTES, TCP228, D17S136E, SIS-delta
• NCBI Gene Id: 6352
• Description of Target: Regulated on Activation, Normal T cell Expressed and Secreted (RANTES) (CCL5) is a proinflammatory chemokine that induces migration and activation of leukocytes, as well as implication in HIV infection. It binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infection displays dependence on concentration and on the binding of cell surface glycosaminoglycans.
• Uniprot ID: P13501
• Molecular Weight: 7.851 kDa