CCL21 Antibody - middle region (ARP80617_P050)

Catalog No: ARP80617_P050

Host: Rabbit
Target Name: CCL21
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCL21
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCL21 (ARP80617_P050) antibody is Catalog # AAP80617

Target Info

• Gene Symbol: CCL21
• Gene Full Name: chemokine (C-C motif) ligand 21
• Alias Symbols: ECL, SLC, CKb9, TCA4, 6Ckine, SCYA21
• NCBI Gene Id: 6366
• Protein Name: C-C motif chemokine 21
• Description of Target: This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19).
• Uniprot ID: O00585
• Protein Accession #: NP_002980.1
• Nucleotide Accession #: NM_002989.3
• Protein Size (# AA): 134
• Molecular Weight: 14 kDa