Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OPCA04070
Price: $0.00
SKU
OPCA04070
Availability: Domestic: within 4-6 weeks delivery | International: 4-6 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CCL18 Recombinant Protein (Human) (OPCA04070)

Datasheets/ManualsPrintable datasheet for OPCA04070
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid
Additional InformationSpecies Specificity Detail: Homo sapiens (Human)
Reconstitution and StorageBriefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
FormulationTris-base, 50% glycerol
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequenceFull Length: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Storage BufferTris-base, 50% glycerol
SourceYeast
TagN-terminal 6xHis-tagged
ReferenceMacrophage inflammatory protein-3 and -4.Li H., Ruben S.Patent number US5504003, 02-APR-1996A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes.Hieshima K., Imai T., Baba M., Shoudai K., Ishizuka K., Nakagawa T., Tsuruta J., Takeya M., Sakaki Y., Takatsuki K., Miura R., Opdenakker G., van Damme J., Yoshie O., Nomiyama H.J. Immunol. 159:1140-1149(1997)
Gene SymbolCCL18
Gene Full NameC-C motif chemokine ligand 18
Alias SymbolsCKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, SCYA18
NCBI Gene Id6362
Protein NameC-C motif chemokine 18
Description of TargetChemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.
Uniprot IDP55774
Protein Accession #NP_002979
Nucleotide Accession #NM_002988
Molecular Weight10 kDa
Write Your Own Review
You're reviewing:CCL18 Recombinant Protein (Human) (OPCA04070)
Your Rating
We found other products you might like!