Search Antibody, Protein, and ELISA Kit Solutions

CCKAR Antibody - N-terminal region : HRP (ARP64107_P050-HRP)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64107_P050 Unconjugated

ARP64107_P050-FITC Conjugated

ARP64107_P050-Biotin Conjugated

Gene Symbol:
CCKAR
Official Gene Full Name:
Cholecystokinin A receptor
NCBI Gene Id:
886
Protein Name:
Cholecystokinin receptor type A
Swissprot Id:
P32238
Protein Accession #:
NP_000721
Nucleotide Accession #:
NM_000730
Alias Symbols:
CCK-A, CCK1-R, CCKRA
Replacement Item:
This antibody may replace item sc-16172 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Protein Size (# AA):
428
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCKAR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCKAR.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%
Complete computational species homology data:
Anti-CCKAR (ARP64107_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
CCKBR; CCKAR; CCK;
Blocking Peptide:
For anti-CCKAR (ARP64107_P050-HRP) antibody is Catalog # AAP64107
Datasheets/Manuals:
Printable datasheet for anti-CCKAR (ARP64107_P050-HRP) antibody
Conjugation:
HRP

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...