Search Antibody, Protein, and ELISA Kit Solutions

CCKAR Antibody - N-terminal region (ARP64107_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64107_P050-FITC Conjugated

ARP64107_P050-HRP Conjugated

ARP64107_P050-Biotin Conjugated

Gene Symbol:
CCKAR
Official Gene Full Name:
Cholecystokinin A receptor
NCBI Gene Id:
886
Protein Name:
Cholecystokinin receptor type A
Swissprot Id:
P32238
Protein Accession #:
NP_000721
Nucleotide Accession #:
NM_000730
Alias Symbols:
CCK-A, CCK1-R, CCKRA
Replacement Item:
This antibody may replace item sc-16172 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Protein Size (# AA):
428
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCKAR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCKAR.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%
Complete computational species homology data:
Anti-CCKAR (ARP64107_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCKBR; CCKAR; CCK;
Blocking Peptide:
For anti-CCKAR (ARP64107_P050) antibody is Catalog # AAP64107
Datasheets/Manuals:
Printable datasheet for anti-CCKAR (ARP64107_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...