Search Antibody, Protein, and ELISA Kit Solutions

CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33849_P050 Unconjugated

ARP33849_P050-FITC Conjugated

ARP33849_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
CCK
Official Gene Full Name:
Cholecystokinin
NCBI Gene Id:
885
Protein Name:
Cholecystokinin
Swissprot Id:
P06307
Protein Accession #:
NP_000720
Nucleotide Accession #:
NM_000729
Alias Symbols:
MGC117187
Replacement Item:
This antibody may replace item sc-20937 from Santa Cruz Biotechnology.
Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
115
Molecular Weight:
13kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCK
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-CCK (ARP33849_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
Blocking Peptide:
For anti-CCK (ARP33849_P050-Biotin) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets/Manuals:
Printable datasheet for anti-CCK (ARP33849_P050-Biotin) antibody
Target Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Publications:

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). IHC, Human, Horse, Dog, Rat, Mouse, Bovine, Rabbit, Pig, Guinea pig 22406641

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...