Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33849_P050 Unconjugated

ARP33849_P050-FITC Conjugated

ARP33849_P050-HRP Conjugated

CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)

Catalog#: ARP33849_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-20937 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCK
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data Anti-CCK (ARP33849_P050)
Peptide Sequence Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Concentration 0.5 mg/ml
Blocking Peptide For anti-CCK (ARP33849_P050-Biotin) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets/Manuals Printable datasheet for anti-CCK (ARP33849_P050-Biotin) antibody
Target Reference Lei,Z.M., (2008) HBPD INT 7 (1), 65-69

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). IHC, Human, Horse, Dog, Rat, Mouse, Bovine, Rabbit, Pig, Guinea pig 22406641

Gene Symbol CCK
Official Gene Full Name Cholecystokinin
Alias Symbols MGC117187
NCBI Gene Id 885
Protein Name Cholecystokinin
Description of Target Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P06307
Protein Accession # NP_000720
Nucleotide Accession # NM_000729
Protein Size (# AA) 115
Molecular Weight 13kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CCK.
Protein Interactions UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
  1. What is the species homology for "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    This target may also be called "MGC117187" in publications.

  5. What is the shipping cost for "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CCK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCK Antibody - middle region : Biotin (ARP33849_P050-Biotin)
Your Rating
We found other products you might like!