Search Antibody, Protein, and ELISA Kit Solutions

CCK antibody - middle region (ARP33849_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33849_P050-FITC Conjugated

ARP33849_P050-HRP Conjugated

ARP33849_P050-Biotin Conjugated

Gene Symbol:
CCK
NCBI Gene Id:
885
Official Gene Full Name:
Cholecystokinin
Protein Name:
Cholecystokinin
Swissprot Id:
P06307
Protein Accession #:
NP_000720
Nucleotide Accession #:
NM_000729
Alias Symbols:
MGC117187
Replacement Item:
This antibody may replace item sc-20937 from Santa Cruz Biotechnology.
Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
115
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCK
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-CCK (ARP33849_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
Blocking Peptide:
For anti-CCK (ARP33849_P050) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets/Manuals:
Printable datasheet for anti-CCK (ARP33849_P050) antibody
Target Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Publications:

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22406641

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...