Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CCK Antibody - middle region (ARP33849_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33849_P050-FITC Conjugated

ARP33849_P050-HRP Conjugated

ARP33849_P050-Biotin Conjugated

Gene Symbol:
CCK
Official Gene Full Name:
Cholecystokinin
NCBI Gene Id:
885
Protein Name:
Cholecystokinin
Swissprot Id:
P06307
Protein Accession #:
NP_000720
Nucleotide Accession #:
NM_000729
Alias Symbols:
MGC117187
Replacement Item:
This antibody may replace item sc-20937 from Santa Cruz Biotechnology.
Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
115
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCK
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-CCK (ARP33849_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
Blocking Peptide:
For anti-CCK (ARP33849_P050) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets/Manuals:
Printable datasheet for anti-CCK (ARP33849_P050) antibody
Target Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Publications:

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22406641

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:08
  • Overall Experience:
  • Quality:
Mouse Brain (frozen sections) in IHC

Submitted by:
Celine Plachez, PhD
University of Maryland, Department of Anatomy & Neurobiology

1. Species and tissue/cell type used: Mouse Brain (frozen sections)

2. Fixation method: Perfusion fixation; Saline then 4% PFA.

3. Antigen retrieval method: None.

4. Primary antibody dilution: 1:2500 dilution

5. Secondary antibody and dilution: 1:500, 2 hr incubation.

6. Stain: Nickel DAB

7. Protocol:
1. Perfusion with Saline then 4% PFA
2. Cryo-protection in 30% sucrose. 50um section using cryostat.
3. Blocking: 1% BSA, 1% normal serum*, in TBST, 1 hour at room temp. (Primary Antibody diluted (1:2500) in the blocking solution overnight at room temp
4. Wash 3 X 5minutes with TBST
5. Secondary antibody diluted in TBST, 2hr at room temp
6. Wash 3 X 5 Minutes with TBST
7. for fluorescent secondary antibody we mounted the sections onto slides at that point.
8. Nickel DAB Staining:
a. ABC incubation, (1/500 of A + 1/500 of B) in TBST, 1hr room temp
b. Wash 3 X 5 Minutes with TBST
c. Nickel DAB
d. Wash 3 X 5 Minutes with TBST
e. Mount sections on slide
f. Dehydrate and DPX mounting media.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...