Size:100 ul
$319.00
In stock
SKU
ARP33849_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33849_P050-FITC Conjugated

ARP33849_P050-HRP Conjugated

ARP33849_P050-Biotin Conjugated

CCK Antibody - middle region (ARP33849_P050)

Rating:
100% of 100
Catalog#: ARP33849_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20937 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCK
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data Anti-CCK (ARP33849_P050)
Peptide Sequence Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CCK (ARP33849_P050) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets/Manuals Printable datasheet for anti-CCK (ARP33849_P050) antibody
Target Reference Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Publications

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22406641

Gene Symbol CCK
Official Gene Full Name Cholecystokinin
Alias Symbols MGC117187
NCBI Gene Id 885
Protein Name Cholecystokinin
Description of Target Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P06307
Protein Accession # NP_000720
Nucleotide Accession # NM_000729
Protein Size (# AA) 115
Molecular Weight 13kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CCK.
Protein Interactions UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
Write Your Own Review
You're reviewing:CCK Antibody - middle region (ARP33849_P050)
Your Rating